Lineage for d4ptvb_ (4ptv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083948Species Halothermothrix orenii [TaxId:373903] [256095] (4 PDB entries)
  8. 2083952Domain d4ptvb_: 4ptv B: [263568]
    automated match to d3ta9a_
    complexed with cs, pe4, tcb

Details for d4ptvb_

PDB Entry: 4ptv (more details), 1.85 Å

PDB Description: Halothermothrix orenii beta-glucosidase A, thiocellobiose complex
PDB Compounds: (B:) Glycoside hydrolase family 1

SCOPe Domain Sequences for d4ptvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ptvb_ c.1.8.0 (B:) automated matches {Halothermothrix orenii [TaxId: 373903]}
iifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdiacdhyhlyre
dielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkanirpmitlyhwd
lpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafeghafgnhapg
tkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdsekdvkaaslld
dyinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflginyysrmvvrh
kpgdnlfnaevvkmedrpstemgweiypqglydilvrvnkeytdkplyitengaafddkl
teegkihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygyskrfgliyvd
yengnrrflkdsalwyreviekgqv

SCOPe Domain Coordinates for d4ptvb_:

Click to download the PDB-style file with coordinates for d4ptvb_.
(The format of our PDB-style files is described here.)

Timeline for d4ptvb_: