Lineage for d4ppdb_ (4ppd B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911709Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 1911789Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 1911790Protein automated matches [195117] (9 species)
    not a true protein
  7. 1911860Species Salmonella enterica [TaxId:99287] [257522] (6 PDB entries)
  8. 1911871Domain d4ppdb_: 4ppd B: [263561]
    automated match to d4ppda_
    complexed with gol, so4

Details for d4ppdb_

PDB Entry: 4ppd (more details), 2.4 Å

PDB Description: PduA K26A, crystal form 2
PDB Compounds: (B:) Propanediol utilization protein pduA

SCOPe Domain Sequences for d4ppdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ppdb_ d.58.56.0 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
hhqqealgmvetkgltaaieaadamvasanvmlvgyekigsglvtvivrgdvgavkaatd
agaaaarnvgevkavhviprphtdvekilpk

SCOPe Domain Coordinates for d4ppdb_:

Click to download the PDB-style file with coordinates for d4ppdb_.
(The format of our PDB-style files is described here.)

Timeline for d4ppdb_: