Lineage for d1ejna_ (1ejn A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319884Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 1319885Species Human (Homo sapiens) [TaxId:9606] [50587] (63 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 1319901Domain d1ejna_: 1ejn A: [26356]
    complexed with agb, so4

Details for d1ejna_

PDB Entry: 1ejn (more details), 1.8 Å

PDB Description: urokinase plasminogen activator b-chain inhibitor complex
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1ejna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejna_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke

SCOPe Domain Coordinates for d1ejna_:

Click to download the PDB-style file with coordinates for d1ejna_.
(The format of our PDB-style files is described here.)

Timeline for d1ejna_: