SCOPe 2.02: Domain d1ejna_: 1ejn A:

Lineage for d1ejna_ (1ejn A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (47 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d1ejna_: 1ejn A: [26356]
   complexed with agb, so4

Details for d1ejna_

PDB Entry: 1ejn, 1.8 Å

PDB Description: urokinase plasminogen activator b-chain inhibitor complex

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1ejna_:

Sequence; same for both SEQRES and ATOM records:

>d1ejna_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke

Timeline for d1ejna_:

• d1ejna_ first appeared (with stable ids) in SCOP 1.55
  
• d1ejna_ appears in SCOPe 2.01
  
• d1ejna_ appears in SCOPe 2.03
  
• d1ejna_ appears in the current release, SCOPe 2.08