Lineage for d1ejna_ (1ejn A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50587] (6 PDB entries) 
Domain d1ejna_: 1ejn A: [26356]
Details for d1ejna_
PDB Entry: 1ejn (more details), 1.8 Å
PDB Description: urokinase plasminogen activator b-chain inhibitor complex
SCOP Domain Sequences for d1ejna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ejna_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke
SCOP Domain Coordinates for d1ejna_:
Click to download the PDB-style file with coordinates for d1ejna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ejna_:
- d1ejna_ appears in SCOP 1.57
- d1ejna_ appears in the current release, SCOPe 2.08
View in 3D