SCOPe 2.08: Domain d4pokc1: 4pok C:1-105

Lineage for d4pokc1 (4pok C:1-105)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d4pokc1: 4pok C:1-105 [263557]
   Other proteins in same PDB: d4poka2, d4pokb2, d4pokc2, d4pokd2
   automated match to d2xbia_
   complexed with com

Details for d4pokc1

PDB Entry: 4pok, 2.52 Å

PDB Description: crystal structures of thioredoxin with mesna at 2.5a resolution

PDB Compounds: (C:) thioredoxin

SCOPe Domain Sequences for d4pokc1:

Sequence; same for both SEQRES and ATOM records:

>d4pokc1 c.47.1.0 (C:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqkalkaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankkkleatinklv

Timeline for d4pokc1:

• d4pokc1 first appeared in SCOPe 2.05, called d4pokc_
  
• d4pokc1 appears in SCOPe 2.07