SCOPe 2.05: Domain d4po5d_: 4po5 D:

Lineage for d4po5d_ (4po5 D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (16 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [193921] (2 PDB entries)

8. Domain d4po5d_: 4po5 D: [263554]
   Other proteins in same PDB: d4po5a_, d4po5c_, d4po5e_
   automated match to d4po5b_
   complexed with cyc, so4

Details for d4po5d_

PDB Entry: 4po5, 1.75 Å

PDB Description: Crystal structure of allophycocyanin B from Synechocystis PCC 6803

PDB Compounds: (D:) allophycocyanin beta chain

SCOPe Domain Sequences for d4po5d_:

Sequence; same for both SEQRES and ATOM records:

>d4po5d_ a.1.1.3 (D:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mqdaitavinsadvqgkyldgaamdklksyfasgelrvraasvisanaativkeavaksl
lysdvtrpggnmyttrryaacirdldyylryatyamlagdasildervlnglketynslg
vpisstvqaiqaikevtaslvgadagkemgvyldyicsgls

Timeline for d4po5d_:

• d4po5d_ is new in SCOPe 2.05-stable
  
• d4po5d_ appears in SCOPe 2.06
  
• d4po5d_ appears in the current release, SCOPe 2.08