Lineage for d4po5c1 (4po5 C:2-161)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302854Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2302855Protein automated matches [190590] (26 species)
    not a true protein
  7. 2303027Species Synechocystis sp. [TaxId:1111708] [260740] (1 PDB entry)
  8. 2303029Domain d4po5c1: 4po5 C:2-161 [263553]
    Other proteins in same PDB: d4po5a2, d4po5b_, d4po5c2, d4po5d_, d4po5e2, d4po5f_
    automated match to d4po5a_
    complexed with cyc, so4

Details for d4po5c1

PDB Entry: 4po5 (more details), 1.75 Å

PDB Description: Crystal structure of allophycocyanin B from Synechocystis PCC 6803
PDB Compounds: (C:) Allophycocyanin subunit alpha-B

SCOPe Domain Sequences for d4po5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4po5c1 a.1.1.0 (C:2-161) automated matches {Synechocystis sp. [TaxId: 1111708]}
svvsqvilqaddqlryptsgelkgiqaflttgaqririaetlaenekkivdqaqkqlfkk
hpeyrapggnaygqrqynqclrdygwylrlvtygvlagnkepiettgligvkemynslnv
pvpgmvdavtvlkdaalgllsaedanetapyfdyiiqfms

SCOPe Domain Coordinates for d4po5c1:

Click to download the PDB-style file with coordinates for d4po5c1.
(The format of our PDB-style files is described here.)

Timeline for d4po5c1: