![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
![]() | Protein automated matches [190590] (26 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1111708] [260740] (1 PDB entry) |
![]() | Domain d4po5c1: 4po5 C:2-161 [263553] Other proteins in same PDB: d4po5a2, d4po5b_, d4po5c2, d4po5d_, d4po5e2, d4po5f_ automated match to d4po5a_ complexed with cyc, so4 |
PDB Entry: 4po5 (more details), 1.75 Å
SCOPe Domain Sequences for d4po5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4po5c1 a.1.1.0 (C:2-161) automated matches {Synechocystis sp. [TaxId: 1111708]} svvsqvilqaddqlryptsgelkgiqaflttgaqririaetlaenekkivdqaqkqlfkk hpeyrapggnaygqrqynqclrdygwylrlvtygvlagnkepiettgligvkemynslnv pvpgmvdavtvlkdaalgllsaedanetapyfdyiiqfms
Timeline for d4po5c1: