Lineage for d1c5y.1 (1c5y A:,B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50587] (6 PDB entries) 
Domain d1c5y.1: 1c5y A:,B: [26355]
Details for d1c5y.1
PDB Entry: 1c5y (more details), 1.65 Å
PDB Description: structural basis for selectivity of a small molecule, s1-binding, sub- micromolar inhibitor of urokinase type plasminogen activator
SCOP Domain Sequences for d1c5y.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1c5y.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
lkfqcgqktXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfid
ypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrc
aqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqp
hyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgv
ytrvshflpwirshtkee
SCOP Domain Coordinates for d1c5y.1:
Click to download the PDB-style file with coordinates for d1c5y.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c5y.1:
- d1c5y.1 appears in SCOP 1.57
- d1c5y.1 appears in the current release, SCOPe 2.08
View in 3D