SCOPe 2.05: Domain d4pmzb_: 4pmz B:

Lineage for d4pmzb_ (4pmz B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:190486] [260217] (9 PDB entries)

8. Domain d4pmzb_: 4pmz B: [263545]
   automated match to d4pmza_
   complexed with bxp, ca

Details for d4pmzb_

PDB Entry: 4pmz, 1.4 Å

PDB Description: crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri complexed with xylobiose

PDB Compounds: (B:) xylanase

SCOPe Domain Sequences for d4pmzb_:

Sequence; same for both SEQRES and ATOM records:

>d4pmzb_ c.1.8.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
aplaataskflgcaygaqqapgfaqywnkltpenggkwgsveavrdqmdwstldaayrfa
qanqmpfqmhvmvwgnqqpewiktlrpaeqrreieqwfaavaqrypdiallevvneplnd
ppskadtgggnylqalggngdsgwewvlqsfrlarrhfphtklmindysitssaqatqky
lqivrllqrenlvdaigvqehafettpevavsvhrdnldalaatglpiyitefdldgptd
aqqladykrvfpvfwehpavhgitlwgfrpglwrdkeaayliradgterpaltwlrdyva
ahp

Timeline for d4pmzb_:

• d4pmzb_ is new in SCOPe 2.05-stable
  
• d4pmzb_ appears in SCOPe 2.06
  
• d4pmzb_ appears in the current release, SCOPe 2.08