Lineage for d4pmuf_ (4pmu F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833324Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2833345Domain d4pmuf_: 4pmu F: [263544]
    automated match to d4pmub_

Details for d4pmuf_

PDB Entry: 4pmu (more details), 2.86 Å

PDB Description: crystal structure of a novel reducing-end xylose-releasing exo- oligoxylanase (xyna) belonging to gh10 family (space group p1211)
PDB Compounds: (F:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d4pmuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pmuf_ c.1.8.0 (F:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
slkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdfs
aadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagry
tgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfnaw
rpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmitel
didvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfwr
krdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsa

SCOPe Domain Coordinates for d4pmuf_:

Click to download the PDB-style file with coordinates for d4pmuf_.
(The format of our PDB-style files is described here.)

Timeline for d4pmuf_: