Lineage for d4pjxa1 (4pjx A:1-178)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (67 PDB entries)
  8. 2507569Domain d4pjxa1: 4pjx A:1-178 [263537]
    Other proteins in same PDB: d4pjxa2, d4pjxa3, d4pjxb1, d4pjxb2, d4pjxc2, d4pjxd_, d4pjxe1, d4pjxe2, d4pjxf1, d4pjxf2, d4pjxg1, d4pjxg2, d4pjxh1, d4pjxh2
    automated match to d4l4vc1
    complexed with 30w, b3p, cl, gol

Details for d4pjxa1

PDB Entry: 4pjx (more details), 2.25 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-a11 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjxa1:

Sequence, based on SEQRES records: (download)

>d4pjxa1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records): (download)

>d4pjxa1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwery
tqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdflif
nkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4pjxa1:

Click to download the PDB-style file with coordinates for d4pjxa1.
(The format of our PDB-style files is described here.)

Timeline for d4pjxa1: