Lineage for d1pfxc_ (1pfx C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Coagulation factor IXa, protease domain [50583] (2 species) 
Species Pig (Sus scrofa) [TaxId:9823] [50584] (1 PDB entry) 
Domain d1pfxc_: 1pfx C: [26353]
Other proteins in same PDB: d1pfxl1, d1pfxl2, d1pfxl3
Details for d1pfxc_
PDB Entry: 1pfx (more details), 3 Å
PDB Description: porcine factor ixa
SCOP Domain Sequences for d1pfxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfxc_ b.47.1.2 (C:) Coagulation factor IXa, protease domain {Pig (Sus scrofa)}
ivggenakpgqfpwqvllngkidafcggsiinekwvvtaahciepgvkitvvageyntee
tepteqrrnviraiphhsynatvnkyshdialleldepltlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfnrgrsatilqylkvplvdratclrstkftiysnmfcagfheggkds
cqgdsggphvtevegtsfltgiiswgeecavkgkygiytkvsryvnwikektklt
SCOP Domain Coordinates for d1pfxc_:
Click to download the PDB-style file with coordinates for d1pfxc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pfxc_:
- d1pfxc_ appears in SCOP 1.57
- d1pfxc_ appears in the current release, SCOPe 2.08
View in 3D
