Lineage for d1pfxc_ (1pfx C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14996Protein Coagulation factor IXa, protease domain [50583] (2 species)
  7. 14999Species Pig (Sus scrofa) [TaxId:9823] [50584] (1 PDB entry)
  8. 15000Domain d1pfxc_: 1pfx C: [26353]
    Other proteins in same PDB: d1pfxl1, d1pfxl2, d1pfxl3

Details for d1pfxc_

PDB Entry: 1pfx (more details), 3 Å

PDB Description: porcine factor ixa

SCOP Domain Sequences for d1pfxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfxc_ b.47.1.2 (C:) Coagulation factor IXa, protease domain {Pig (Sus scrofa)}
ivggenakpgqfpwqvllngkidafcggsiinekwvvtaahciepgvkitvvageyntee
tepteqrrnviraiphhsynatvnkyshdialleldepltlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfnrgrsatilqylkvplvdratclrstkftiysnmfcagfheggkds
cqgdsggphvtevegtsfltgiiswgeecavkgkygiytkvsryvnwikektklt

SCOP Domain Coordinates for d1pfxc_:

Click to download the PDB-style file with coordinates for d1pfxc_.
(The format of our PDB-style files is described here.)

Timeline for d1pfxc_: