SCOPe 2.08: Domain d4pjeh2: 4pje H:116-242

Lineage for d4pjeh2 (4pje H:116-242)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4pjeh2: 4pje H:116-242 [263527]
   Other proteins in same PDB: d4pjea1, d4pjea2, d4pjeb1, d4pjeb2, d4pjec1, d4pjec2, d4pjed1, d4pjed2, d4pjee1, d4pjef1, d4pjeg1, d4pjeh1
   automated match to d3of6b2
   complexed with 30w, act, cl, gol, na

Details for d4pjeh2

PDB Entry: 4pje, 1.95 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-b10 tcr

PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pjeh2:

Sequence; same for both SEQRES and ATOM records:

>d4pjeh2 b.1.1.2 (H:116-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

Timeline for d4pjeh2:

• d4pjeh2 first appeared in SCOPe 2.05
  
• d4pjeh2 appears in SCOPe 2.07