![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d4pjee1: 4pje E:2-110 [263524] Other proteins in same PDB: d4pjea1, d4pjeb1, d4pjeb2, d4pjec1, d4pjed1, d4pjed2, d4pjee2, d4pjef2, d4pjeg2, d4pjeh2 automated match to d2f54d1 complexed with 30w, act, cl, gol, na |
PDB Entry: 4pje (more details), 1.95 Å
SCOPe Domain Sequences for d4pjee1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjee1 b.1.1.0 (E:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs sflsrskgysylllkelqmkdsasylcagmdsnyqliwgagtkliikpd
Timeline for d4pjee1: