Lineage for d4pjec2 (4pje C:179-269)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355657Domain d4pjec2: 4pje C:179-269 [263523]
    Other proteins in same PDB: d4pjea1, d4pjeb1, d4pjeb2, d4pjec1, d4pjed1, d4pjed2, d4pjee2, d4pjef2, d4pjeg2, d4pjeh2
    automated match to d4l4va2
    complexed with 30w, act, cl, gol, na

Details for d4pjec2

PDB Entry: 4pje (more details), 1.95 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-b10 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjec2:

Sequence, based on SEQRES records: (download)

>d4pjec2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d4pjec2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnralfckahgfyppeiymtwmkngeeidygdilpsgdgtyqawasielnlys
chvehsgvhmvlqv

SCOPe Domain Coordinates for d4pjec2:

Click to download the PDB-style file with coordinates for d4pjec2.
(The format of our PDB-style files is described here.)

Timeline for d4pjec2: