| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4pjec2: 4pje C:179-269 [263523] Other proteins in same PDB: d4pjea1, d4pjeb1, d4pjeb2, d4pjec1, d4pjed1, d4pjed2, d4pjee2, d4pjef2, d4pjeg2, d4pjeh2 automated match to d4l4va2 complexed with 30w, act, cl, gol, na |
PDB Entry: 4pje (more details), 1.95 Å
SCOPe Domain Sequences for d4pjec2:
Sequence, based on SEQRES records: (download)
>d4pjec2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv
>d4pjec2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnralfckahgfyppeiymtwmkngeeidygdilpsgdgtyqawasielnlys
chvehsgvhmvlqv
Timeline for d4pjec2: