Lineage for d4pjec1 (4pje C:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938692Domain d4pjec1: 4pje C:1-178 [263522]
    Other proteins in same PDB: d4pjea2, d4pjeb1, d4pjeb2, d4pjec2, d4pjed1, d4pjed2, d4pjee1, d4pjee2, d4pjef1, d4pjef2, d4pjeg1, d4pjeg2, d4pjeh1, d4pjeh2
    automated match to d4l4vc1
    complexed with 30w, act, cl, gol, na

Details for d4pjec1

PDB Entry: 4pje (more details), 1.95 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-b10 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjec1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4pjec1:

Click to download the PDB-style file with coordinates for d4pjec1.
(The format of our PDB-style files is described here.)

Timeline for d4pjec1: