SCOPe 2.07: Domain d4pjea2: 4pje A:179-269

Lineage for d4pjea2 (4pje A:179-269)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4pjea2: 4pje A:179-269 [263521]
   Other proteins in same PDB: d4pjea1, d4pjeb1, d4pjeb2, d4pjec1, d4pjed1, d4pjed2, d4pjee2, d4pjef2, d4pjeg2, d4pjeh2
   automated match to d4l4va2
   complexed with 30w, act, cl, gol, na

Details for d4pjea2

PDB Entry: 4pje, 1.95 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-b10 tcr

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjea2:

Sequence, based on SEQRES records:

>d4pjea2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records):

>d4pjea2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasiellyschvehsgvhmvlqv

Timeline for d4pjea2:

• d4pjea2 first appeared in SCOPe 2.05
  
• d4pjea2 appears in SCOPe 2.06
  
• d4pjea2 appears in the current release, SCOPe 2.08