SCOPe 2.01: Domain d1fujd_: 1fuj D:

Lineage for d1fujd_ (1fuj D:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Myeloblastin, PR3 [50581] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50582] (1 PDB entry)

8. Domain d1fujd_: 1fuj D: [26352]

Details for d1fujd_

PDB Entry: 1fuj, 2.2 Å

PDB Description: pr3 (myeloblastin)

PDB Compounds: (D:) pr3

SCOPe Domain Sequences for d1fujd_:

Sequence; same for both SEQRES and ATOM records:

>d1fujd_ b.47.1.2 (D:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]}
ivggheaqphsrpymaslqmrgnpgshfcggtlihpsfvltaahclrdipqrlvnvvlga
hnvrtqeptqqhfsvaqvflnnydaenklndilliqlsspanlsasvatvqlpqqdqpvp
hgtqclamgwgrvgahdppaqvlqelnvtvvtffcrphnictfvprrkagicfgdsggpl
icdgiiqgidsfviwgcatrlfpdfftrvalyvdwirstlr

Timeline for d1fujd_:

• d1fujd_ first appeared (with stable ids) in SCOP 1.55
  
• d1fujd_ appears in SCOP 1.75
  
• d1fujd_ appears in SCOPe 2.02
  
• d1fujd_ appears in the current release, SCOPe 2.08