Lineage for d4pjde1 (4pjd E:2-110)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356630Domain d4pjde1: 4pjd E:2-110 [263518]
    Other proteins in same PDB: d4pjda1, d4pjda3, d4pjdb_, d4pjdc1, d4pjdc3, d4pjdd_, d4pjde2, d4pjdf2, d4pjdg2, d4pjdh2
    automated match to d2f54d1
    complexed with 2lj, gol

Details for d4pjde1

PDB Entry: 4pjd (more details), 2.78 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-c10 tcr
PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pjde1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjde1 b.1.1.0 (E:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavvdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d4pjde1:

Click to download the PDB-style file with coordinates for d4pjde1.
(The format of our PDB-style files is described here.)

Timeline for d4pjde1: