SCOPe 2.08: Domain d4pjde1: 4pjd E:2-110

Lineage for d4pjde1 (4pjd E:2-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4pjde1: 4pjd E:2-110 [263518]
   Other proteins in same PDB: d4pjda1, d4pjda3, d4pjdb_, d4pjdc1, d4pjdc3, d4pjdd_, d4pjde2, d4pjdf2, d4pjdg2, d4pjdh2
   automated match to d2f54d1
   complexed with 2lj, gol

Details for d4pjde1

PDB Entry: 4pjd, 2.78 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-c10 tcr

PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pjde1:

Sequence; same for both SEQRES and ATOM records:

>d4pjde1 b.1.1.0 (E:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavvdsnyqliwgagtkliikpd

Timeline for d4pjde1:

• d4pjde1 first appeared in SCOPe 2.05
  
• d4pjde1 appears in SCOPe 2.07