Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries) |
Domain d4pjdc1: 4pjd C:0-178 [263516] Other proteins in same PDB: d4pjda2, d4pjdb_, d4pjdc2, d4pjdd_, d4pjde1, d4pjde2, d4pjdf1, d4pjdf2, d4pjdg1, d4pjdg2, d4pjdh1, d4pjdh2 automated match to d4l4vc1 complexed with 2lj, gol |
PDB Entry: 4pjd (more details), 2.78 Å
SCOPe Domain Sequences for d4pjdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjdc1 d.19.1.0 (C:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4pjdc1: