![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d4pjbc2: 4pjb C:179-269 [263513] Other proteins in same PDB: d4pjba1, d4pjba3, d4pjbb_, d4pjbc1, d4pjbc3, d4pjbd_, d4pjbe2, d4pjbf2, d4pjbg2, d4pjbh2 automated match to d4l4va2 complexed with 2lj, gol |
PDB Entry: 4pjb (more details), 2.85 Å
SCOPe Domain Sequences for d4pjbc2:
Sequence, based on SEQRES records: (download)
>d4pjbc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasieldpqssnlyschvehsgvhmvlqv
>d4pjbc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrkevtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgtyqawa siellyschvehsgvhmvlqv
Timeline for d4pjbc2: