Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d4pjbc1: 4pjb C:1-178 [263512] Other proteins in same PDB: d4pjba2, d4pjba3, d4pjbb_, d4pjbc2, d4pjbc3, d4pjbd_, d4pjbe1, d4pjbe2, d4pjbf1, d4pjbf2, d4pjbg1, d4pjbg2, d4pjbh1, d4pjbh2 automated match to d4l4vc1 complexed with 2lj, gol |
PDB Entry: 4pjb (more details), 2.85 Å
SCOPe Domain Sequences for d4pjbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjbc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4pjbc1: