Lineage for d4pj9a1 (4pj9 A:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938703Domain d4pj9a1: 4pj9 A:1-178 [263510]
    Other proteins in same PDB: d4pj9a2, d4pj9a3, d4pj9b1, d4pj9b2, d4pj9c1, d4pj9c2, d4pj9d1, d4pj9d2
    automated match to d4l4vc1
    complexed with 2lj, gol, na

Details for d4pj9a1

PDB Entry: 4pj9 (more details), 2 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait traj20 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj9a1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4pj9a1:

Click to download the PDB-style file with coordinates for d4pj9a1.
(The format of our PDB-style files is described here.)

Timeline for d4pj9a1: