SCOP 1.67: Domain d1fujc_: 1fuj C:

Lineage for d1fujc_ (1fuj C:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein Myeloblastin, PR3 [50581] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50582] (1 PDB entry)

8. Domain d1fujc_: 1fuj C: [26351]

Details for d1fujc_

PDB Entry: 1fuj, 2.2 Å

PDB Description: pr3 (myeloblastin)

SCOP Domain Sequences for d1fujc_:

Sequence; same for both SEQRES and ATOM records:

>d1fujc_ b.47.1.2 (C:) Myeloblastin, PR3 {Human (Homo sapiens)}
ivggheaqphsrpymaslqmrgnpgshfcggtlihpsfvltaahclrdipqrlvnvvlga
hnvrtqeptqqhfsvaqvflnnydaenklndilliqlsspanlsasvatvqlpqqdqpvp
hgtqclamgwgrvgahdppaqvlqelnvtvvtffcrphnictfvprrkagicfgdsggpl
icdgiiqgidsfviwgcatrlfpdfftrvalyvdwirstlr

Timeline for d1fujc_:

• d1fujc_ first appeared (with stable ids) in SCOP 1.55
  
• d1fujc_ appears in SCOP 1.65
  
• d1fujc_ appears in SCOP 1.69
  
• d1fujc_ appears in the current release, SCOPe 2.08