Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
Domain d4pj7c1: 4pj7 C:1-178 [263508] Other proteins in same PDB: d4pj7a2, d4pj7a3, d4pj7b_, d4pj7c2, d4pj7c3, d4pj7d_, d4pj7e1, d4pj7e2, d4pj7f1, d4pj7f2, d4pj7g1, d4pj7g2, d4pj7h1, d4pj7h2 automated match to d4l4vc1 complexed with 2lj |
PDB Entry: 4pj7 (more details), 2.5 Å
SCOPe Domain Sequences for d4pj7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj7c1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4pj7c1: