Lineage for d4pj5c2 (4pj5 C:179-269)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755152Domain d4pj5c2: 4pj5 C:179-269 [263505]
    Other proteins in same PDB: d4pj5a1, d4pj5b1, d4pj5b2, d4pj5c1, d4pj5d2, d4pj5f_, d4pj5g2
    automated match to d4l4va2
    complexed with 30w

Details for d4pj5c2

PDB Entry: 4pj5 (more details), 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pj5c2:

Sequence, based on SEQRES records: (download)

>d4pj5c2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d4pj5c2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrkalfckahgfyppeiymtwmkngeeidygdilpsgdgtyqawasieldpq
ssnlyschvehsgvhmvlqv

SCOPe Domain Coordinates for d4pj5c2:

Click to download the PDB-style file with coordinates for d4pj5c2.
(The format of our PDB-style files is described here.)

Timeline for d4pj5c2: