SCOPe 2.07: Domain d4pj5c1: 4pj5 C:1-178

Lineage for d4pj5c1 (4pj5 C:1-178)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)

8. Domain d4pj5c1: 4pj5 C:1-178 [263504]
   Other proteins in same PDB: d4pj5a2, d4pj5b1, d4pj5b2, d4pj5c2, d4pj5d1, d4pj5d2, d4pj5e1, d4pj5e2, d4pj5f_, d4pj5g1, d4pj5g2, d4pj5h1, d4pj5h2
   automated match to d4l4vc1
   complexed with 30w

Details for d4pj5c1

PDB Entry: 4pj5, 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pj5c1:

Sequence; same for both SEQRES and ATOM records:

>d4pj5c1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d4pj5c1:

• d4pj5c1 first appeared in SCOPe 2.05
  
• d4pj5c1 appears in SCOPe 2.06
  
• d4pj5c1 appears in the current release, SCOPe 2.08