| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein automated matches [190118] (16 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
| Domain d4pihb_: 4pih B: [263496] automated match to d4piha_ complexed with ca, cl; mutant |
PDB Entry: 4pih (more details), 1.5 Å
SCOPe Domain Sequences for d4pihb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pihb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdsegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg
Timeline for d4pihb_: