SCOPe 2.08: Domain d4phxg1: 4phx G:1-120

Lineage for d4phxg1 (4phx G:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187451] (6 PDB entries)

8. Domain d4phxg1: 4phx G:1-120 [263491]
   Other proteins in same PDB: d4phxa2, d4phxb2, d4phxc2, d4phxd2, d4phxe2, d4phxf2, d4phxg2, d4phxh2
   automated match to d4phxc_

Details for d4phxg1

PDB Entry: 4phx, 2.4 Å

PDB Description: crystal structure of aggb, the minor subunit of aggregative adherence fimbriae type i from the escherichia coli o4h104

PDB Compounds: (G:) Protein AggB

SCOPe Domain Sequences for d4phxg1:

Sequence, based on SEQRES records:

>d4phxg1 b.2.3.0 (G:1-120) automated matches {Escherichia coli [TaxId: 562]}
aeitlishktlgsqlrdgmklatgriacrephdgfhiwinasqngkvghyivqnnretkh
elkvkiggggwsssliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisr

Sequence, based on observed residues (ATOM records):

>d4phxg1 b.2.3.0 (G:1-120) automated matches {Escherichia coli [TaxId: 562]}
aeitlishlgsqlrdgmklatgriacrephdgfhiwinasqvghyivqnnhelkvkiggg
gwsssliegqrgvyrqgeekqaifdimsdgnqysageyifsvsgeclisr

Timeline for d4phxg1:

• d4phxg1 first appeared in SCOPe 2.05, called d4phxg_
  
• d4phxg1 appears in SCOPe 2.07