Lineage for d4phxg1 (4phx G:1-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767842Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2767843Protein automated matches [190503] (10 species)
    not a true protein
  7. 2767867Species Escherichia coli [TaxId:562] [187451] (6 PDB entries)
  8. 2767884Domain d4phxg1: 4phx G:1-120 [263491]
    Other proteins in same PDB: d4phxa2, d4phxb2, d4phxc2, d4phxd2, d4phxe2, d4phxf2, d4phxg2, d4phxh2
    automated match to d4phxc_

Details for d4phxg1

PDB Entry: 4phx (more details), 2.4 Å

PDB Description: crystal structure of aggb, the minor subunit of aggregative adherence fimbriae type i from the escherichia coli o4h104
PDB Compounds: (G:) Protein AggB

SCOPe Domain Sequences for d4phxg1:

Sequence, based on SEQRES records: (download)

>d4phxg1 b.2.3.0 (G:1-120) automated matches {Escherichia coli [TaxId: 562]}
aeitlishktlgsqlrdgmklatgriacrephdgfhiwinasqngkvghyivqnnretkh
elkvkiggggwsssliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisr

Sequence, based on observed residues (ATOM records): (download)

>d4phxg1 b.2.3.0 (G:1-120) automated matches {Escherichia coli [TaxId: 562]}
aeitlishlgsqlrdgmklatgriacrephdgfhiwinasqvghyivqnnhelkvkiggg
gwsssliegqrgvyrqgeekqaifdimsdgnqysageyifsvsgeclisr

SCOPe Domain Coordinates for d4phxg1:

Click to download the PDB-style file with coordinates for d4phxg1.
(The format of our PDB-style files is described here.)

Timeline for d4phxg1: