Lineage for d4phxe1 (4phx E:1-123)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2363595Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2363797Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2364168Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2364169Protein automated matches [190503] (9 species)
    not a true protein
  7. 2364175Species Escherichia coli [TaxId:562] [187451] (5 PDB entries)
  8. 2364189Domain d4phxe1: 4phx E:1-123 [263490]
    Other proteins in same PDB: d4phxa2, d4phxb2, d4phxc2, d4phxd2, d4phxe2, d4phxf2, d4phxg2, d4phxh2
    automated match to d4phxc_

Details for d4phxe1

PDB Entry: 4phx (more details), 2.4 Å

PDB Description: Crystal structure of AggB, the minor subunit of aggregative adherence fimbriae type I from the Escherichia coli O4H104
PDB Compounds: (E:) Protein AggB

SCOPe Domain Sequences for d4phxe1:

Sequence, based on SEQRES records: (download)

>d4phxe1 b.2.3.0 (E:1-123) automated matches {Escherichia coli [TaxId: 562]}
aeitlishktlgsqlrdgmklatgriacrephdgfhiwinasqngkvghyivqnnretkh
elkvkiggggwsssliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisr
gdn

Sequence, based on observed residues (ATOM records): (download)

>d4phxe1 b.2.3.0 (E:1-123) automated matches {Escherichia coli [TaxId: 562]}
aeitligsqlrdmklatgriacrephdgfhiwinasqhyivqnnrkhelkvkiggggwss
sliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisgn

SCOPe Domain Coordinates for d4phxe1:

Click to download the PDB-style file with coordinates for d4phxe1.
(The format of our PDB-style files is described here.)

Timeline for d4phxe1: