Lineage for d4phty1 (4pht Y:2-145)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493591Species Vibrio vulnificus [TaxId:216895] [261241] (1 PDB entry)
  8. 2493594Domain d4phty1: 4pht Y:2-145 [263485]
    automated match to d4phtx1
    complexed with anp, mg, zn

Details for d4phty1

PDB Entry: 4pht (more details), 2.83 Å

PDB Description: atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
PDB Compounds: (Y:) type II secretion system protein l

SCOPe Domain Sequences for d4phty1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4phty1 c.55.1.0 (Y:2-145) automated matches {Vibrio vulnificus [TaxId: 216895]}
sefltvrlsseqyspipwlvwsssqqeviasgelsdwqqlddlknyaeqrpivvlvaasd
vvltevdippgasrqfesmlpylledeiaqdvddlhfsvlakengkaqvcgvdrrwlqhm
ldafraqgldvkrvlpdslalpld

SCOPe Domain Coordinates for d4phty1:

Click to download the PDB-style file with coordinates for d4phty1.
(The format of our PDB-style files is described here.)

Timeline for d4phty1: