SCOPe 2.06: Domain d4phty1: 4pht Y:2-145

Lineage for d4phty1 (4pht Y:2-145)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (52 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [261241] (1 PDB entry)

8. Domain d4phty1: 4pht Y:2-145 [263485]
   automated match to d4phtx1
   complexed with anp, mg, zn

Details for d4phty1

PDB Entry: 4pht, 2.83 Å

PDB Description: atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system

PDB Compounds: (Y:) type II secretion system protein l

SCOPe Domain Sequences for d4phty1:

Sequence; same for both SEQRES and ATOM records:

>d4phty1 c.55.1.0 (Y:2-145) automated matches {Vibrio vulnificus [TaxId: 216895]}
sefltvrlsseqyspipwlvwsssqqeviasgelsdwqqlddlknyaeqrpivvlvaasd
vvltevdippgasrqfesmlpylledeiaqdvddlhfsvlakengkaqvcgvdrrwlqhm
ldafraqgldvkrvlpdslalpld

Timeline for d4phty1:

• d4phty1 first appeared in SCOPe 2.05
  
• d4phty1 appears in SCOPe 2.07
  
• d4phty1 appears in the current release, SCOPe 2.08