Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Vibrio vulnificus [TaxId:216895] [261241] (1 PDB entry) |
Domain d4phty1: 4pht Y:2-145 [263485] automated match to d4phtx1 complexed with anp, mg, zn |
PDB Entry: 4pht (more details), 2.83 Å
SCOPe Domain Sequences for d4phty1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4phty1 c.55.1.0 (Y:2-145) automated matches {Vibrio vulnificus [TaxId: 216895]} sefltvrlsseqyspipwlvwsssqqeviasgelsdwqqlddlknyaeqrpivvlvaasd vvltevdippgasrqfesmlpylledeiaqdvddlhfsvlakengkaqvcgvdrrwlqhm ldafraqgldvkrvlpdslalpld
Timeline for d4phty1: