Lineage for d4phmb_ (4phm B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2320686Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2320700Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 2320701Species Human (Homo sapiens) [TaxId:9606] [47553] (9 PDB entries)
  8. 2320712Domain d4phmb_: 4phm B: [263483]
    automated match to d1kfxs_
    complexed with 2ud, ca

Details for d4phmb_

PDB Entry: 4phm (more details), 2.03 Å

PDB Description: the structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids
PDB Compounds: (B:) Calpain small subunit 1

SCOPe Domain Sequences for d4phmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4phmb_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir
rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d4phmb_:

Click to download the PDB-style file with coordinates for d4phmb_.
(The format of our PDB-style files is described here.)

Timeline for d4phmb_: