Lineage for d4pg3b2 (4pg3 B:229-581)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1921049Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1921050Protein automated matches [226887] (9 species)
    not a true protein
  7. 1921101Species Plasmodium falciparum [TaxId:36329] [234567] (2 PDB entries)
  8. 1921103Domain d4pg3b2: 4pg3 B:229-581 [263477]
    Other proteins in same PDB: d4pg3a1, d4pg3b1, d4pg3c1, d4pg3d1
    automated match to d3bjua2
    complexed with krs, lys

Details for d4pg3b2

PDB Entry: 4pg3 (more details), 2.7 Å

PDB Description: crystal structure of krs complexed with inhibitor
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4pg3b2:

Sequence, based on SEQRES records: (download)

>d4pg3b2 d.104.1.0 (B:229-581) automated matches {Plasmodium falciparum [TaxId: 36329]}
dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar
pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy
wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie
kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi
vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekg
dteaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrp

Sequence, based on observed residues (ATOM records): (download)

>d4pg3b2 d.104.1.0 (B:229-581) automated matches {Plasmodium falciparum [TaxId: 36329]}
dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar
pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy
wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie
kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi
vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfldsafctsle
yglpptgglglgidritmfltnknsikdvilfptmrp

SCOPe Domain Coordinates for d4pg3b2:

Click to download the PDB-style file with coordinates for d4pg3b2.
(The format of our PDB-style files is described here.)

Timeline for d4pg3b2: