Lineage for d4pddc1 (4pdd C:32-332)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915978Species Polaromonas sp. [TaxId:296591] [257484] (2 PDB entries)
  8. 2915981Domain d4pddc1: 4pdd C:32-332 [263472]
    Other proteins in same PDB: d4pdda2, d4pddb2, d4pddc2
    automated match to d4pdda_
    complexed with eax, fmt, mla

Details for d4pddc1

PDB Entry: 4pdd (more details), 1.7 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate
PDB Compounds: (C:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4pddc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pddc1 c.94.1.0 (C:32-332) automated matches {Polaromonas sp. [TaxId: 296591]}
etilkigytppkdshygvgattfcdevekgtqerykcqhfpssalggeremiesvqlgtq
dlvntstgplgnfvpetrivdipflfrdyeharkvmdgaigqdllkkmqakgliglawte
ngfrhmtnskrpilqasdaaglkvrtmenkvhmdgyktfgllptpmafpelftalqqgtv
dgqenpipvilsskfsqvqkhlsltghvyspavlilssrvwdklseadkkvfvaaaqkat
vaqrkrvnddeangitqlkkdgmqvvekvdgesfrkavapayagfakefgaeriaaiqav
k

SCOPe Domain Coordinates for d4pddc1:

Click to download the PDB-style file with coordinates for d4pddc1.
(The format of our PDB-style files is described here.)

Timeline for d4pddc1: