SCOPe 2.06: Domain d4pddb1: 4pdd B:32-332

Lineage for d4pddb1 (4pdd B:32-332)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Polaromonas sp. [TaxId:296591] [257484] (2 PDB entries)

8. Domain d4pddb1: 4pdd B:32-332 [263471]
   Other proteins in same PDB: d4pdda2, d4pddb2, d4pddc2
   automated match to d4pdda_
   complexed with eax, fmt, mla

Details for d4pddb1

PDB Entry: 4pdd, 1.7 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate

PDB Compounds: (B:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4pddb1:

Sequence; same for both SEQRES and ATOM records:

>d4pddb1 c.94.1.0 (B:32-332) automated matches {Polaromonas sp. [TaxId: 296591]}
etilkigytppkdshygvgattfcdevekgtqerykcqhfpssalggeremiesvqlgtq
dlvntstgplgnfvpetrivdipflfrdyeharkvmdgaigqdllkkmqakgliglawte
ngfrhmtnskrpilqasdaaglkvrtmenkvhmdgyktfgllptpmafpelftalqqgtv
dgqenpipvilsskfsqvqkhlsltghvyspavlilssrvwdklseadkkvfvaaaqkat
vaqrkrvnddeangitqlkkdgmqvvekvdgesfrkavapayagfakefgaeriaaiqav
k

Timeline for d4pddb1:

• d4pddb1 first appeared in SCOPe 2.05, called d4pddb_
  
• d4pddb1 appears in SCOPe 2.07
  
• d4pddb1 appears in the current release, SCOPe 2.08