Lineage for d4pcad1 (4pca D:1-218)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146612Species Anaplasma phagocytophilum [TaxId:1217107] [257458] (2 PDB entries)
  8. 2146616Domain d4pcad1: 4pca D:1-218 [263467]
    Other proteins in same PDB: d4pcaa2, d4pcab2, d4pcac2, d4pcad2
    automated match to d4pcaa_
    complexed with edo, mn, sah

Details for d4pcad1

PDB Entry: 4pca (more details), 1.5 Å

PDB Description: x-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah and manganese
PDB Compounds: (D:) O-methyltransferase family protein

SCOPe Domain Sequences for d4pcad1:

Sequence, based on SEQRES records: (download)

>d4pcad1 c.66.1.0 (D:1-218) automated matches {Anaplasma phagocytophilum [TaxId: 1217107]}
mrnvslskqdeylnklfavdtegalkahktapselrmaqlgtvegqmlqllirmagihsi
vevgtcvgfsaicmahalpskghiytiekdyenvvtanqnivnckledkitvlhgealaq
lntlkemapfdmifidankssylaylnwakmyirkgglivadntflfgsvfdehptekvs
snahasmrafndelankekylstiiptsegmmvsiklt

Sequence, based on observed residues (ATOM records): (download)

>d4pcad1 c.66.1.0 (D:1-218) automated matches {Anaplasma phagocytophilum [TaxId: 1217107]}
mrnvslskqdeylnklfavdtegalkahktapselrmaqlgtvegqmlqllirmagihsi
vevgtcvgfsaicmahalpskghiytiekdyenvvtanqnivnckledkitvlhgealaq
lntlkemapfdmifidankssylaylnwakmyirkgglivadntflfgsvfdehpekvss
nahasmrafndelankekylstiiptsegmmvsiklt

SCOPe Domain Coordinates for d4pcad1:

Click to download the PDB-style file with coordinates for d4pcad1.
(The format of our PDB-style files is described here.)

Timeline for d4pcad1: