![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries) |
![]() | Domain d4pbvd1: 4pbv D:29-122 [263463] automated match to d2yd3a1 complexed with nag, so4 |
PDB Entry: 4pbv (more details), 2.5 Å
SCOPe Domain Sequences for d4pbvd1:
Sequence, based on SEQRES records: (download)
>d4pbvd1 b.1.1.0 (D:29-122) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnkkgkkvnsqrfetiefdesaga vlriqplrtprdeniyecvaqnphgevtvhaklt
>d4pbvd1 b.1.1.0 (D:29-122) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnkkvnsqrfetiefdesagavlr iqplrtprdeniyecvaqnphgevtvhaklt
Timeline for d4pbvd1:
![]() Domains from other chains: (mouse over for more information) d4pbvc1, d4pbvc2, d4pbve1, d4pbve2 |