| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
| Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
| Protein automated matches [254423] (5 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [255101] (5 PDB entries) |
| Domain d4p7ib2: 4p7i B:104-214 [263443] Other proteins in same PDB: d4p7ia1, d4p7ia3, d4p7ib1, d4p7ib3 automated match to d1h4ra1 complexed with gol |
PDB Entry: 4p7i (more details), 2.6 Å
SCOPe Domain Sequences for d4p7ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p7ib2 a.11.2.0 (B:104-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl
Timeline for d4p7ib2: