![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins) |
![]() | Protein Anaphase promoting complex (APC) [74680] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74682] (4 PDB entries) Uniprot Q13616 17-776 |
![]() | Domain d4p5oc2: 4p5o C:687-776 [263437] Other proteins in same PDB: d4p5oa1, d4p5ob_, d4p5oc1, d4p5od_, d4p5og1, d4p5og2, d4p5og3, d4p5oh_, d4p5oi1, d4p5oi2, d4p5oi3, d4p5ok_ automated match to d1ldja1 complexed with zn |
PDB Entry: 4p5o (more details), 3.11 Å
SCOPe Domain Sequences for d4p5oc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p5oc2 a.4.5.34 (C:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]} pmkteqkqeqetthknieedrklliqaaivrimrmrkvlkhqqllgevltqlssrfkprv pvikkcidiliekeylervdgekdtysyla
Timeline for d4p5oc2: