Class a: All alpha proteins [46456] (290 folds) |
Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) |
Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins) can be classified as disulfide-rich Pfam PF01821 |
Protein automated matches [257397] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [257398] (2 PDB entries) |
Domain d4p3bd1: 4p3b D:679-745 [263435] Other proteins in same PDB: d4p3ba2, d4p3bb2, d4p3bc2, d4p3bd2 automated match to d1kjsa_ complexed with fmt |
PDB Entry: 4p3b (more details), 2.1 Å
SCOPe Domain Sequences for d4p3bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p3bd1 a.50.1.1 (D:679-745) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafneccti ankirke
Timeline for d4p3bd1: