Lineage for d4p3bc1 (4p3b C:679-746)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714706Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714707Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2714708Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2714726Protein automated matches [257397] (2 species)
    not a true protein
  7. 2714730Species Mouse (Mus musculus) [TaxId:10090] [257398] (2 PDB entries)
  8. 2714737Domain d4p3bc1: 4p3b C:679-746 [263434]
    Other proteins in same PDB: d4p3ba2, d4p3bb2, d4p3bc2, d4p3bd2
    automated match to d1kjsa_
    complexed with fmt

Details for d4p3bc1

PDB Entry: 4p3b (more details), 2.1 Å

PDB Description: crystal structure of the mouse c5a-desarg anaphylatoxin
PDB Compounds: (C:) Complement C5

SCOPe Domain Sequences for d4p3bc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3bc1 a.50.1.1 (C:679-746) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafneccti
ankirkes

SCOPe Domain Coordinates for d4p3bc1:

Click to download the PDB-style file with coordinates for d4p3bc1.
(The format of our PDB-style files is described here.)

Timeline for d4p3bc1: