Lineage for d4p3ac_ (4p3a C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737052Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1737053Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 1737054Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 1737072Protein automated matches [257397] (2 species)
    not a true protein
  7. 1737076Species Mouse (Mus musculus) [TaxId:10090] [257398] (2 PDB entries)
  8. 1737079Domain d4p3ac_: 4p3a C: [263431]
    automated match to d1kjsa_
    complexed with fmt

Details for d4p3ac_

PDB Entry: 4p3a (more details), 1.4 Å

PDB Description: crystal structure of the mouse c5a anaphylatoxin
PDB Compounds: (C:) Complement C5

SCOPe Domain Sequences for d4p3ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3ac_ a.50.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
anlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecct
iankirke

SCOPe Domain Coordinates for d4p3ac_:

Click to download the PDB-style file with coordinates for d4p3ac_.
(The format of our PDB-style files is described here.)

Timeline for d4p3ac_: