Lineage for d4p2sh_ (4p2s H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198653Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2198733Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2198734Protein automated matches [195117] (12 species)
    not a true protein
  7. 2198810Species Salmonella enterica [TaxId:702982] [257392] (1 PDB entry)
  8. 2198818Domain d4p2sh_: 4p2s H: [263426]
    automated match to d4ppda_
    complexed with gol, so4, trs

Details for d4p2sh_

PDB Entry: 4p2s (more details), 1.94 Å

PDB Description: Alanine Scanning Mutagenesis Identifies an Asparagine-Arginine-Lysine Triad Essential to Assembly of the Shell of the Pdu Microcompartment
PDB Compounds: (H:) Putative propanediol utilization protein PduA

SCOPe Domain Sequences for d4p2sh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p2sh_ d.58.56.0 (H:) automated matches {Salmonella enterica [TaxId: 702982]}
qqealgmvetkgltaaieaadamvasanvmlvgyekigsglvtvivrgdvgavkaatdag
aaaarnvgevkavhviprphtdvekilpk

SCOPe Domain Coordinates for d4p2sh_:

Click to download the PDB-style file with coordinates for d4p2sh_.
(The format of our PDB-style files is described here.)

Timeline for d4p2sh_: