![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
![]() | Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
![]() | Protein automated matches [195117] (12 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:702982] [257392] (1 PDB entry) |
![]() | Domain d4p2sd_: 4p2s D: [263422] automated match to d4ppda_ complexed with gol, so4, trs |
PDB Entry: 4p2s (more details), 1.94 Å
SCOPe Domain Sequences for d4p2sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p2sd_ d.58.56.0 (D:) automated matches {Salmonella enterica [TaxId: 702982]} qealgmvetkgltaaieaadamvasanvmlvgyekigsglvtvivrgdvgavkaatdaga aaarnvgevkavhviprphtdvekilpk
Timeline for d4p2sd_: