| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (22 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries) |
| Domain d4p2ck_: 4p2c K: [263421] Other proteins in same PDB: d4p2ca_, d4p2cb_, d4p2cc_, d4p2cd_, d4p2ce_, d4p2cf_, d4p2cj2 automated match to d3ezjb_ |
PDB Entry: 4p2c (more details), 2.82 Å
SCOPe Domain Sequences for d4p2ck_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p2ck_ b.1.1.1 (K:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyrd
svkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtvs
Timeline for d4p2ck_: