SCOPe 2.07: Domain d4p1bc_: 4p1b C:

Lineage for d4p1bc_ (4p1b C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (2 families)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.0: automated matches [191572] (1 protein)
   not a true family

6. Protein automated matches [190991] (1 species)
   not a true protein

7. Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)

8. Domain d4p1bc_: 4p1b C: [263409]
   Other proteins in same PDB: d4p1ba_, d4p1bd_, d4p1bh_, d4p1bi_
   automated match to d3ge3c_
   complexed with act, fe, fes, na, peg

Details for d4p1bc_

PDB Entry: 4p1b, 2.05 Å

PDB Description: crystal structure of the toluene 4-monooxygenase hydroxylase- ferredoxin c7s e16c c84a c85a variant electron-transfer complex

PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d4p1bc_:

Sequence; same for both SEQRES and ATOM records:

>d4p1bc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

Timeline for d4p1bc_:

• d4p1bc_ first appeared in SCOPe 2.05
  
• d4p1bc_ appears in SCOPe 2.06
  
• d4p1bc_ appears in the current release, SCOPe 2.08